PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G1059
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 267aa    MW: 30230.4 Da    PI: 5.0452
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G1059genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.4e-192370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  l+ +v+ +G g+W+++ar  g++Rt+k+c++rw++yl
      Gh_A08G1059 23 KGPWTEEEDFTLKAYVNIHGEGRWNSVARLSGLKRTGKSCRLRWLNYL 70
                     79********************************************97 PP

2Myb_DNA-binding48.32.3e-1576119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ + +E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Gh_A08G1059  76 RGNISLQEQLLILQLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 119
                      788899****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.7071874IPR017930Myb domain
SuperFamilySSF466894.87E-3120117IPR009057Homeodomain-like
SMARTSM007178.5E-172272IPR001005SANT/Myb domain
PfamPF002493.9E-172370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-222477IPR009057Homeodomain-like
CDDcd001671.85E-122570No hitNo description
SMARTSM007179.1E-1475123IPR001005SANT/Myb domain
PROSITE profilePS5129418.45875125IPR017930Myb domain
PfamPF002493.0E-1476119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2178124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MDVYETGFIS ETPQSEEDMD VKKGPWTEEE DFTLKAYVNI HGEGRWNSVA RLSGLKRTGK  60
SCRLRWLNYL RPEVRRGNIS LQEQLLILQL HSRWGNRWSK IAQHLPGRTD NEIKNYWRTR  120
VQKQAKQLKC DVNSKQFRDA MRYVWIPRLV EQICASSGSH SAQQSSSTTT TYADTIGSVR  180
VDPSLLPELS GTSSDSLDAQ VSSVSDLTNS KYPNSLQNGS GSGNTIAGTW GGVEIEATDG  240
GDSMESVWNE EDIWFLRQQL YDDDDLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-252012524128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.156570.0boll| ovule| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475004.11e-180PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE14e-74MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D2R4U61e-180A0A0D2R4U6_G
STRINGPOPTR_0002s19250.15e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.12e-77myb domain protein 2